Glucagon – Like Peptide 1 (7 – 37)
TECHNICAL SPECIFICATIONS
| Item | Specification |
|---|---|
| Product Name | Glucagon-Like Peptide 1 (7-37), GLP-1 (7-37) |
| CAS NO. | |
| Appearance | White to off-white lyophilized powder |
| Molecular Formula | C151H226N40O46 |
| Molecular Weight | 3337.73g/mol |
| Amino Acid Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG) |
| Purity (RP-HPLC) | ≥95.0% |
| Solubility | Soluble in water (up to 1 mg/mL) |
| Endotoxin | ≤1.0 EU/mg |
| Biological Activity | Potent insulinotropic hormone that stimulates glucose-dependent insulin secretion, reduces glucagon release, and slows gastric emptying. Used in diabetes research and incretin-based therapeutic development. |
| Storage Conditions | Store at –20°C, protected from light and moisture. For long-term storage, recommend –80°C. |
| Stock Location | Stock in USA |
| MOQ | 10mg |
1.MECHANISM OF ACTION
This peptide activates the GLP-1 receptor on pancreatic β‑cells, stimulating adenylate cyclase and elevating intracellular cAMP. This results in glucose-dependent insulin secretion, suppression of glucagon release, delayed gastric emptying, and promotion of β‑cell proliferation and survival.
2.PRODUCT INDICATIONS
Glucagon-Like Peptide 1 (7-37) is widely used in studies of type‑2 diabetes, obesity, and metabolic syndrome. It serves as a reference standard in drug discovery, diagnostic assay development, and preclinical evaluation of GLP‑1‑based therapeutics.
3.CLINICAL EFFICACY OF PRODUCT
Clinical and preclinical data demonstrate that Glucagon-Like Peptide 1 (7-37) effectively improves glycemic control, enhances insulin sensitivity, reduces body weight, and protects pancreatic β‑cell function, supporting its role as a foundational molecule for incretin‑based therapies.
We specialize in global logistics for various cosmetic peptides. Your order will be handled with the utmost care, ensuring safe, reliable, and intact delivery.
Professional and Secure Packaging
Each bottle of peptide is protected with a special packaging solution to ensure stability and integrity during transportation.
We can also customize packaging according to customer needs.
Shipping Methods
Main Method: International Air Freight
We primarily use DHL, FedEx, UPS, and TNT because of their global reliability, speed, and advanced tracking systems. Air freight ensures the fastest transit time and minimizes the impact of environmental factors on the product.
