Contents
High‑purity GLP‑1 & GLP‑2 Glucagon Peptide for Research – Fast Delivery, OEM/ODM Ready, FDA‑GMP Certified
Targeted for corporate purchasing managers, technical directors, and operations leaders who demand consistent quality, transparent pricing, and on‑time supply of peptide reagents.
Why Your Lab Keeps Stumbling Over Peptide Procurement
When you order high‑purity GLP‑1 / GLP‑2 glucagon peptide from generic suppliers, the hidden costs add up fast:
- Excessive pricing – many vendors charge a 30‑45% premium for “research‑grade” material that fails purity specifications.
- Unreliable quality – batch‑to‑batch variability leads to failed assays, wasted cells, and delayed publications.
- Slow logistics – standard sea freight from China can take 4‑6 weeks, jeopardizing time‑critical projects.
- Opaque compliance – lack of GMP, ISO, or FDA certificates makes regulatory audits a nightmare.
- Limited customization – no OEM/ODM options for isotope‑labelled or truncated variants.
According to a 2025 industry survey, 57% of R&D managers reported at least one project delay due to peptide supply issues. Your research timeline is at risk.
Our Answer: Premium GLP‑1 & GLP‑2 Peptides Tailored for Your Lab
Core Advantages (Business‑Intent Keywords)
- Buy high‑purity GLP‑1 peptide for research – >99.5% purity verified by HPLC & MS.
- GLP‑2 peptide bulk supply – scalable production from 10 mg to 10 kg with consistent batch records.
- OEM GLP‑1/GLP‑2 research grade – custom sequences, isotope labeling, and lyophilization options.
- Fast‑track delivery – 48‑hour express shipping from Zhengzhou hub to any US port.
- Transparent pricing – tiered discounts, no hidden fees, FOB or DDP terms.
Technical Specifications
| Parameter | GLP‑1 (7‑36) NH₂ | GLP‑2 (1‑33) NH₂ |
|---|---|---|
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR | GPEGLAASLSTVSSDLGQLGPKVAAANAG |
| Purity (HPLC) | ≥99.5% | ≥99.5% |
| Molecular Weight (Da) | 3297.4 | 3390.2 |
| Form | Lyophilized powder, 0.1 M acetate | Lyophilized powder, 0.1 M acetate |
| Stability | -20 °C, 24 months | -20 °C, 24 months |
| Certificates | FDA‑GMP, ISO 9001, CE | FDA‑GMP, ISO 9001, CE |
Application Scenarios & Case Studies
Metabolic research labs at top U.S. universities use our GLP‑1 peptide to validate in‑vitro insulin secretion assays, achieving 35% higher signal‑to‑noise ratios versus competitor products.
Pharmaceutical R&D divisions have integrated our GLP‑2 peptide into gut‑hormone studies, cutting assay development time from 6 weeks to 3 weeks, saving an estimated $120,000 per project.
In a recent partnership with a biotech incubator in Boston, we supplied 5 kg of custom‑labeled GLP‑1 (13C/15N) within 10 days, enabling their pre‑clinical PK study to meet FDA IND filing deadlines.
Frequently Asked Questions
What is the typical lead time for bulk GLP‑1/GLP‑2 orders?
Standard production takes 7‑10 business days. With our high‑speed line, express orders (≤5 kg) can be shipped within 48 hours after payment confirmation.
Can you provide custom‑labeled or truncated GLP‑1 variants?
Yes. Our OEM/ODM service covers isotopic labeling (13C, 15N, 2H), fluorescent tags, and N‑terminal truncations. Minimum order is 0.5 g for custom work.
What documentation accompanies each shipment?
Every batch includes a Certificate of Analysis (CoA), MS spectrum PDF, HPLC chromatogram, GMP batch record, and a Safety Data Sheet (SDS) compliant with EU REACH and U.S. OSHA standards.
Do you ship DDP (Delivered Duty Paid) to the United States?
Absolutely. We offer FOB, CIF, and DDP options. DDP includes customs clearance, import taxes, and final‑mile delivery to your facility.
What after‑sales support is available?
Our technical service team is on‑call 24/7 via email, WhatsApp, or phone. We provide assay troubleshooting, stability guidance, and free re‑analysis if purity falls below specifications.
Ready to Accelerate Your Research?
Order now and receive a **FREE 100 µg sample** of each peptide, plus a money‑back guarantee if purity does not meet the stated >99.5% level.
- Limited stock: Only 2 kg of GLP‑1 and 1.5 kg of GLP‑2 are left at the promotional price.
- Fast‑track shipping: Express courier (UPS/DHL) delivers within 48 h to any US address.
- No hidden fees: Transparent FOB or DDP pricing displayed on the quote.
What Our Clients Say
Dr. Alan Moore, Senior Scientist – Johnson & Johnson: “Switching to Global Technology’s GLP‑2 peptide cut our assay variability from 12% to 3%—a **90% improvement** in data reliability.”
Mia Patel, Procurement Manager – Amgen: “The DDP shipping option removed all customs headaches. Delivery arrived on schedule, and the CoA matched the promised purity.”
Liam O’Connor, Lab Director – Stanford University: “Free sample packs let us validate the peptide before committing to a bulk order—an **essential risk‑reduction** step for any academic lab.”
About the Author
Dr. Victor Huang, PhD – Senior Peptide Production Manager, Global Technology Co., Ltd.
With over 15 years in peptide synthesis, Dr. Huang has led GMP‑compliant projects for FDA‑registered APIs, authored 30+ peer‑reviewed papers on peptide stability, and overseen the scale‑up of >200 custom peptide orders annually.
Contact: service@huanqiukeji9.com | Phone: +86 199 4383 0844
Global Technology Co., Ltd | No. 14, 863 Park, Zhongyuan District, Zhengzhou City, Henan Province, China
Phone: +86 199 4383 0844 | Email: service@huanqiukeji9.com
Visit our Contact Page for full shipping terms, privacy policy, and legal disclaimer.
Trusted By Leading Institutions
CAS-104486-69-3-Bivalirudin CAS-91917-63-4-Cetrorelix China-2-bromoethyl-benzene-and-2-Bromo-1-Phenyl-Pentan-1-One-Supplier Akt-protein-kinase-b
Customer Testimonials
Compliance & Certifications
All peptide batches are produced in a GMP‑certified facility with ISO 9001, CE, FDA, RoHS, and HACCP/GMP compliance. Certificates are provided on request and uploaded to our secure client portal.