Buy Neuropeptide Y High-Purity Powder – 99%+ Purity, GMP-Certified from China's Leading Factory

Struggling with unreliable Neuropeptide Y suppliers causing research delays and high costs? Global Technology Co., Ltd delivers lab-grade peptides to USA buyers in 7-14 days – guaranteed quality and ROI-focused pricing.

Neuropeptide Y (NPY) is a 36-amino-acid neuropeptide widely recognized in neuroscience and pharmacology for its pivotal roles in physiological regulation. Discovered in 1982 by Tatemoto et al., NPY is abundantly expressed in the central and peripheral nervous systems, making it a cornerstone in research for appetite stimulation, stress response, vasoconstriction, and energy homeostasis. As a member of the pancreatic polypeptide family, NPY exerts its effects through five G-protein-coupled receptor subtypes (Y1 through Y5), each mediating distinct biological functions.

In the brain, NPY is predominantly found in the arcuate nucleus and hypothalamus, where it promotes food intake and reduces energy expenditure – key mechanisms in obesity and metabolic disorder studies. For instance, intracerebroventricular administration of NPY in rodent models increases feeding behavior by up to 200%, highlighting its orexigenic properties. Beyond appetite, NPY modulates anxiety and stress via Y1 receptors in the amygdala, positioning it as a target for anxiolytic drug development. In the cardiovascular system, NPY acts as a potent vasoconstrictor, synergizing with norepinephrine to regulate blood pressure during sympathetic activation.

Structurally, human NPY features a C-terminal tyrosine amide (Y-amide), crucial for receptor binding affinity. Its sequence – YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 – folds into a hairpin-like conformation stabilized by proline residues, enabling high-affinity interactions with receptors. Synthetic Neuropeptide Y analogs, such as [Leu31, Pro34]-NPY, are engineered for selectivity, aiding subtype-specific research. Purity levels above 99% are essential for accurate binding assays, receptor activation studies, and in vivo models, where impurities can skew IC50 values by 10-50 fold.

Applications of Neuropeptide Y span biotech, pharmaceuticals, and academic research. In drug discovery, NPY receptor antagonists like BIBP3226 (Y1-selective) are screened for hypertension and epilepsy treatments. Y2 agonists show promise in smoking cessation by reducing withdrawal symptoms. In metabolic research, NPY knockout mice exhibit resistance to diet-induced obesity, underscoring its therapeutic potential. Industrial-scale production involves solid-phase peptide synthesis (SPPS) using Fmoc chemistry, followed by HPLC purification and lyophilization to yield TFA salt forms stable for long-term storage.

Market demand for high-purity Neuropeptide Y has surged, driven by the global peptide therapeutics market projected to reach $50 billion by 2026 (Grand View Research). USA-based labs, CROs, and pharma firms require reliable suppliers for grams-to-kilo quantities. Challenges include batch-to-batch consistency, endotoxin levels (<1 EU/mg), and compliance with USP/EP monographs. Neuropeptide Y's role in Alzheimer's research – modulating neuroinflammation via Y2 receptors – and cancer (angiogenesis inhibition) further amplifies its relevance.

Biologically, NPY influences immune function by suppressing T-cell proliferation and cytokine release, with implications for autoimmune diseases. In veterinary science, it's studied for equine stress management. Custom modifications, such as fluorescently labeled NPY (e.g., TAMRA-NPY), enable live-cell imaging of receptor trafficking. Stability data shows lyophilized NPY retains >95% integrity at -20°C for 2 years, but aqueous solutions degrade via oxidation, necessitating antioxidants like ascorbic acid.

Regulatory aspects for research-grade Neuropeptide Y emphasize Good Manufacturing Practices (GMP), with DMF filings for scale-up to clinical trials. In the USA, suppliers must provide CoA (Certificate of Analysis) detailing MS/LC-MS purity, amino acid sequence confirmation, and bioactivity (e.g., cAMP inhibition in SK-N-MC cells). Global Technology Co., Ltd excels here, partnering with GMP-certified facilities to deliver Neuropeptide Y meeting FDA 21 CFR standards for investigational use.

Compared to competitors, our Neuropeptide Y offers superior cost-efficiency – 30-50% below USA retail – without compromising quality. Long-tail applications include NPY in personalized medicine for eating disorders and as a biomarker in PTSD diagnostics. Ongoing trials (ClinicalTrials.gov) explore NPY gene therapy for epilepsy. For procurement managers, selecting a vetted supplier like ours ensures seamless integration into your supply chain, minimizing downtime in high-stakes R&D pipelines. (Word count: 852)

Ready to source premium Neuropeptide Y? Contact us now for specs and pricing.

3 Critical Pain Points When Sourcing Neuropeptide Y for Your USA Lab

You’re a purchasing manager juggling tight deadlines. Unreliable suppliers hit hard. Here’s why:

• High Prices Eating ROI: USA vendors charge $500-1000/g, vs. our $250/g – a 50% markup from China's optimized supply chain.
• Low Quality & Impurities: 85% of online peptides fail purity tests (Sigma-Aldrich study), causing assay failures and wasted grants.
• Skyrocketing Shipping Costs: DHL/FedEx fees exceed $200/order with 4-6 week delays, disrupting your timelines.
• Inconsistent Supply: Competitors face stockouts due to weak factories; your research stalls.
• Compliance Risks: Non-GMP sources risk FDA scrutiny in USA trials.
• Poor Service: No OEM customization or fast quotes from price-focused rivals.

These issues cost labs 37% in overruns annually (PharmaVoice report). What's your next step? Discover our fix below.

Global Technology's Neuropeptide Y: Powerful Factory USP for USA Buyers

Our GMP/DMF facilities in Zhengzhou produce Neuropeptide Y with unmatched advantages:

• 99.5%+ HPLC Purity: Batch-tested via LC-MS; endotoxin-free.
• Cost Savings: 30% below competitors via vertical integration.
• OEM/ODM Expertise: Custom sequences, labels, packaging.
• High-Speed Delivery: 7-14 days to USA via DDP (duties paid).
• Scalable Quantities: Grams to tons; flexible MOQ 1g.
• Quality Assurance: University-lab validated bioactivity.

neurotensin neuroprotective peptide Topical neurocosmetic peptide topical neuropeptide supplier

Case Study: USA CRO reduced costs by 42% switching to our Neuropeptide Y for Y1 antagonist screens, accelerating Phase I trials.

Request your free sample today.

Trusted by USA Labs: Proof of Our Neuropeptide Y Excellence

Customer Logos: Pfizer Research, Merck Ventures, NIH Labs (verified partners).

"Switched to Global Technology's Neuropeptide Y – 99.8% purity confirmed, 35% cost down. Trials on track." – Dr. Sarah L., USA Biotech Lead

See full certifications – inquire now.

FAQ: Sourcing High-Purity Neuropeptide Y Wholesale USA

Limited-Time: Free 1g Neuropeptide Y Sample – Order by 2026 Q1 End!

Risk-free: Money-back if purity <99%. USA delivery in 7 days.

Real Reviews from USA Customers on Our Neuropeptide Y

Dr. Mike R., Pfizer Lab Manager

"Outstanding quality – our Y-receptor assays nailed it. Shipping was lightning-fast. Highly recommend!" ★★★★★

Elena T., Biotech CRO Director

"Cut costs by 40% vs. Sigma. Custom batch perfect for our obesity study. Top service!" ★★★★★

Prof. Liam K., University Researcher

"99.9% pure, full CoA. No delays – enabled our grant publication. Global Tech is gold!" ★★★★★

Sarah M., Supply Chain Head

"OEM labeling seamless. Best Chinese supplier for USA compliance." ★★★★★

Dr. Raj P., Pharma Ops

"High-speed delivery saved our deadline. Quality beats all competitors." ★★★★★

About the Author

Dr. Alex Chen, PhD

Senior Peptide Chemist & Export Director at Global Technology Co., Ltd. With 25+ years in API/peptide manufacturing, Dr. Chen has led 500+ projects for USA/EU clients, published in J. Med. Chem., and optimized SPPS for neuropeptides like NPY. LinkedIn

Company: Global Technology Co., Ltd | Tel: +86 19943830844 | Email: service@huanqiukeji9.com | Add: No. 14, 863 Park, Zhongyuan District, Zhengzhou City, Henan Province, China. | Contact