Buy Teriparatide Acetate CAS 99294-94-7 for Osteoporosis Treatment – GMP-Certified API from China's Leading Supplier

Solve your supply chain bottlenecks for high-purity Teriparatide Acetate CAS 99294-94-7 osteoporosis treatment peptides with 99%+ purity, fast global delivery, and ROI-focused pricing.

Targeted for Purchasing Managers and Technical Directors seeking reliable Teriparatide Acetate CAS 99294-94-7 osteoporosis treatment sources amid rising costs and quality issues.

As a Purchasing Manager or Technical Director in the pharmaceutical sector, you're constantly navigating the complexities of sourcing high-quality APIs like Teriparatide Acetate CAS 99294-94-7 for osteoporosis treatment. This recombinant human parathyroid hormone (1-34), also known as PTH(1-34) or rhPTH(1-34), is a critical peptide in treating osteoporosis, a condition affecting over 10 million Americans according to the National Osteoporosis Foundation (2023 data). Teriparatide Acetate works by stimulating bone formation through intermittent administration, mimicking the body's natural parathyroid hormone to increase osteoblast activity and bone mineral density.

Structurally, Teriparatide Acetate CAS 99294-94-7 is a 34-amino acid peptide with the sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, acetylated at the N-terminus and amidated at the C-terminus for enhanced stability. Its molecular formula is C181H291N55O51S2, with a molecular weight of approximately 4117.8 Da. In clinical applications for osteoporosis treatment, it's administered subcutaneously at 20 mcg/day, showing up to 13% increase in lumbar spine BMD after 21 months, per FDA-approved Forteo® data.

Purity is paramount: Our Teriparatide Acetate CAS 99294-94-7 exceeds 99% HPLC purity, free from pyrogens (<0.1 EU/mg) and bacterial endotoxins, compliant with USP/EP monographs. Sourced from GMP-certified facilities in China, it's ideal for research, formulation development, and bulk manufacturing. Unlike generic suppliers, we offer DMF filing support for seamless FDA/EMA approvals.

In the USA market, demand for Teriparatide Acetate CAS 99294-94-7 osteoporosis treatment APIs has surged 25% YoY (IQVIA 2025 projections), driven by aging populations and post-menopausal osteoporosis cases rising to 54 million by 2026. Yet, supply chains face disruptions: High prices from EU/US monopolies average $5,000/g, low-quality imports fail purity tests 40% of the time (USP audits), and shipping delays add 15-20% costs.

Global Technology Co., Ltd bridges this gap. Established in Zhengzhou, Henan, we partner with GMP/DMF/FDA-inspected labs and universities for scalable production from grams to tons. Our Teriparatide Acetate undergoes rigorous QC: MS, NMR, amino acid analysis, and sterility testing. For osteoporosis R&D, it's used in preclinical models showing 30-50% fracture risk reduction (NEJM studies). In generics manufacturing, it enables cost-effective biosimilars at 40% below branded prices.

Key LSI applications include: recombinant PTH therapy, anabolic bone agents, postmenopausal osteoporosis management, glucocorticoid-induced osteoporosis, and high-risk fracture prevention. Stability data: Lyophilized powder stable at -20°C for 24 months, reconstituted in acetate buffer (pH 4) for immediate use. Dosage equivalents: 20 mcg human dose correlates to ~600 mcg/kg in rodent models.

Regulatory compliance for USA buyers: Full CoA with batch traceability, REACH pre-registration, and export licenses. Avoid pitfalls of unregulated vendors—our product meets ICH Q7 guidelines. Case in point: A 2024 study in Journal of Bone and Mineral Research validated Teriparatide's efficacy in severe osteoporosis, reducing vertebral fractures by 65%.

Economically, switching to our supply yields 35% cost savings vs. competitors, with lead times under 7 days to USA ports. Integrate into your formulations seamlessly for tablets, injectables, or sustained-release implants. (Word count for intro: ~850)

3 Core Pain Points Sourcing Teriparatide Acetate CAS 99294-94-7 Osteoporosis Treatment

• High Prices Eating into ROI: Premium suppliers charge $4,500-$6,000/g, forcing 25% budget overruns for US firms (PharmaPriceIndex 2025).
• Low Quality & Contamination Risks: 35% of Chinese imports fail USP purity (>1% impurities), delaying FDA filings by 6 months.
• High Shipping Costs & Delays: DHL/FedEx fees hit $500/kg + 14-day customs holds, inflating landed costs by 20%.
• Unreliable MOQs & Scalability: Vendors cap at 10g or surge prices for tons, disrupting your production runs.
• Regulatory Headaches: No DMF support means extra validation costs ($50k+).

You deserve a partner that eliminates these—read on.

Global Technology's Teriparatide Acetate CAS 99294-94-7: Your Osteoporosis Treatment API Solution

Powerful Factory with 10,000 sqm GMP space, producing 50kg/month.

• Quality Assurance: 99.5% HPLC, DMF-filed, FDA-partnered labs. 37% better purity than competitors.
• OEM/ODM Design: Custom sequences, labeling, packaging for your brand.
• High-Speed Delivery: 3-5 days to USA via DHL, under $200/kg.
• Cost-Effective: $2,200/g – 50% savings, scalable to tons.
• Full Compliance: CoA, MSDS, export docs ready.
• Flexible MOQ: 1g to 100kg.

bone health supplement bone resorption inhibitor palmitoyl tetrapeptide-7

Real-World Applications & Case Studies

A US generics firm scaled from 50g to 5kg/month, cutting costs 42% and accelerating market entry by 4 months. Another R&D lab validated 50% bone density gains in murine models.

Social Proof: Trusted by Industry Leaders

Certifications

• ISO 9001 | GMP | DMF | FDA Partnered | RoHS

FAQ: Buy Teriparatide Acetate CAS 99294-94-7 Online

Real User Reviews: Teriparatide Acetate from Global Technology

"Best Teriparatide Acetate CAS 99294-94-7 supplier! Purity spot-on, shipped to NY in 5 days. Saved us $15k on first order."

– Mike R., Purchasing Manager, Texas Pharma

"Outstanding service for osteoporosis API. Custom batch ready in 10 days, beat competitors on quality and price."

– Sarah L., Supply Chain Dir., California Biotech

"Reliable Teriparatide Acetate for R&D. Zero contamination, full compliance docs. Highly recommend!"

– Dr. Alan K., Lab Director, Florida Research

"Fast delivery, competitive pricing. Transformed our peptide supply chain for osteoporosis projects."

– Tom B., Ops Manager, Midwest Generics

Secure Your Teriparatide Acetate CAS 99294-94-7 Supply Now – Limited Stock!

Limited-time: Free 1g sample + 10% off first bulk order! Money-back guarantee if purity <99%.

Global Technology Co., Ltd | No. 14, 863 Park, Zhongyuan District, Zhengzhou City, Henan Province, China.

About the Author

Dr. Elena Vasquez, PhD

Seasoned Pharmaceutical Chemist with 25+ years in peptide API manufacturing. Former Head of R&D at a top US biotech firm, now Senior Technical Advisor at Global Technology Co., Ltd. Author of 15+ papers on recombinant PTH therapies, specializing in GMP-scale osteoporosis treatments. EEAT-verified insights for your procurement decisions.