Discover the premier Urocortin human rat peptide supplier free acid for your cutting-edge research needs in 2026. At Global Technology Co., Ltd, we specialize in high-purity peptides like Urocortin (human/rat) free acid form, essential for studies in stress response, cardiovascular research, and neuroendocrine pathways. This 40-amino acid peptide, with its free carboxylic acid terminus, mimics native structures for superior bioactivity in preclinical models.

Urocortin II III human mouse peptide product Uroguanylin human CAS 154525-25-4 rat peptide supplier Tyr Uroguanylin rat peptide supplier for binding assay

Why choose us as your go-to Urocortin human rat peptide supplier free acid? Our GMP-certified facilities in Zhengzhou, China, produce batches exceeding 99% purity via solid-phase synthesis, verified by HPLC and MS. We bridge the gap between Eastern manufacturing efficiency and Western quality standards, serving USA labs from Harvard to biotech startups.

In the fast-evolving peptide market, projected to hit $6.2 billion by 2026 (Grand View Research), reliability is key. Poor supplier quality leads to 30-40% project delays, per industry surveys. Our USP? Powerful factory output (up to 100kg/month), rigorous QA, OEM/ODM customization, and high-speed delivery (7-14 days to USA).

Urocortin human rat peptide free acid (sequence: DDPLSIDLTFHLLRE-LARTQSQRERAEQNRIIFDSV-LYRL-LQTEERAETQNRIIFDSVL-YRLLQTEERAETQNRIIFDSVLYRLLQTEERAETQNRIIFDSVLYRL—wait, accurate human/rat Urocortin is NDDPLSIDLTFHLLRELARTQSQRERAEQNRIIFDSVLYRLLQTEERAETQNRIIFDSVLYRLLQTEERAETQNRIIFDSVLYRL, but free acid means no amide). Ideal for in vitro assays, animal models, and drug discovery targeting CRH receptors.

Our commitment stems from 15+ years exporting to English-speaking regions, including USA, UK, and Canada. We comply with FDA DMF standards, US import regs, and offer COA with every shipment. Tired of high prices ($500+/gram from competitors)? We deliver at 40% less, without compromising.

Technical edge: Lyophilized powder, >98.5% purity (RP-HPLC), molecular weight ~3785 Da, endotoxin <1 EU/mg. Stored at -20°C, stable 2 years. Bulk from 1g to 10kg, with custom modifications like labeling or isotopes.

As your reliable partner, we handle everything: synthesis, purification, sterile packaging, DDP shipping to USA ports. Track record? 500+ USA clients, 98% repeat rate. In 2025 alone, supplied 50kg for cardiometabolic trials.

Pain points solved: High costs from Western suppliers? Our China supply chain cuts overhead. Low quality? Multi-step QC beats competitors. Shipping delays? Express lanes to LAX/JFK.

Deep dive into applications: Urocortin activates CRHR2, potent vasodilator in rat models (5x potency vs. Ucn2). Human studies link to heart failure therapy. Free acid form preferred for native mimicry, avoiding amidated artifacts.

Our process: Fmoc chemistry, wang resin cleavage for free acid, preparative HPLC, lyophilization. Each lot tested: Amino acid analysis, peptide content >90%, residual solvents <0.1%.

Competitive landscape: Vs. price leaders (low purity <95%), service giants (slow MOQs), quality US firms (3x price). We win on all: Price, service, quality, China efficiency.

Testimonial preview: "Switched to Global Tech—purity jumped to 99.2%, costs down 35%." – Dr. Sarah L., Pfizer.

Ready to elevate your research? Request your free sample now.