Glucagon – Like Peptide 1, (GLP – 1) amide, human CAS NO.99658-04-5

Glucagon – Like Peptide 1, (GLP – 1) amide, human CAS NO.99658-04-5

Glucagon – Like Peptide 1, (GLP – 1) amide, human  CAS NO.99658-04-5

Glucagon – Like Peptide 1, (GLP – 1) amide, human CAS NO.99658-04-5

Glucagon – Like Peptide 1, (GLP – 1) amide, human CAS NO.99658-04-5

Glucagon-Like Peptide 1 (GLP-1) amide, human is the definitive, bioactive 31-amino acid incretin hormone (sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂) produced by post-translational processing of proglucagon in intestinal L-cells. The C-terminal amidation is a critical natural modification that ensures full receptor binding affinity and biological activity. As the primary active form, it is a master regulator of glucose homeostasis, potently stimulating glucose-dependent insulin secretion while suppressing glucagon release, slowing gastric emptying, and promoting satiety. Supplied as a high-purity (>97%) lyophilized powder, it is the indispensable reference standard for all research involving the GLP-1 pathway, drug discovery, and metabolic physiology.



TECHNICAL SPECIFICATIONS


Item
Specification
Product Name
Glucagon-Like Peptide 1, (GLP-1) amide, human
CAS NO.
99658-04-5
Appearance
White to off-white lyophilized powder
Molecular Formula
C184H273N51O57
Molecular Weight
4111.53g/mol 
Purity (RP-HPLC)
≥98%
Solubility

Soluble in water (≥ 10 mg/mL), dilute acetic acid, or DMSO; readily dissolves in physiological buffers.

Endotoxin≤1.0 EU/mg
Biological Activity
Stimulates insulin secretion in a glucose-dependent manner; EC₅₀ typically ≤ 0.1 nM in cell-based assays.
Storage Conditions
Store at -20°C to -80°C in a desiccated environment; avoid repeated freeze-thaw cycles. Stable for 2 years when stored as directed.
Stock Location
Stock in USA
MOQ
1g


1.MECHANISM OF ACTION

Human GLP-1 amide exerts its multifaceted metabolic effects through specific, high-affinity binding to the GLP-1 Receptor (GLP-1R), a Class B G-protein coupled receptor widely expressed in pancreatic islets, the brain, heart, and gastrointestinal tract. Receptor activation predominantly couples to the Gs protein, stimulating adenylate cyclase to elevate intracellular cyclic AMP (cAMP). This activates two main effector pathways: Protein Kinase A (PKA) and the cAMP-regulated guanine nucleotide exchange factor (Epac2). In pancreatic beta cells, this integrated signaling potentiates glucose-stimulated insulin secretion, enhances insulin gene expression, and promotes beta-cell proliferation and survival. Concurrently, it inhibits glucagon secretion from alpha cells. In the brainstem and hypothalamus, it activates neural circuits to induce satiety and reduce food intake, while in the stomach, it delays gastric emptying via vagal inhibition.


    2.PRODUCT INDICATIONS

  • Beta-Cell Biology & Diabetes Research: Defining the gold-standard insulinotropic response in primary islets, beta-cell lines (INS-1, MIN6), and models of diabetes to study secretion, proliferation, and cytoprotection.

  • GLP-1 Receptor (GLP-1R) Pharmacology: Serving as the native, high-potency reference agonist for receptor binding assays, cAMP accumulation studies, calcium flux measurements, and β-arrestin recruitment assays.

  • Drug Discovery & Screening: Acting as the critical benchmark for evaluating the potency, efficacy, and signaling bias of all synthetic GLP-1R agonists (e.g., liraglutide, semaglutide) and multi-agonists (e.g., tirzepatide) in development.

  • Central Control of Metabolism: Investigating GLP-1's anorexigenic effects in neuronal cultures, brain slices, and feeding behavior studies.


    3.CLINICAL EFFICACY OF PRODUCT

  • Established Physiological Power: As the major incretin, it is responsible for the "incretin effect," potentiating up to 70% of postprandial insulin secretion in a glucose-dependent manner, thereby minimizing hypoglycemia risk.

  • Therapeutic Limitation & Innovation: Its rapid degradation by dipeptidyl peptidase-4 (DPP-IV), leading to a<2-minute half-life="">DPP-IV-resistant GLP-1 receptor agonists.

  • Foundation for Blockbuster Drugs: This peptide's mechanism is the basis for numerous highly successful drugs:
    • GLP-1R Agonists (Injectable/Oral): Liraglutide (Victoza®), Semaglutide (Ozempic®, Wegovy®, Rybelsus®), Dulaglutide (Trulicity®) – proven for superior glycemic control, weight loss, and cardiovascular/renal benefits.

    • Dual/Triple Agonists: Tirzepatide (Mounjaro®/Zepbound®), a GIP/GLP-1 dual agonist, shows even greater efficacy.

  • Proven Clinical Impact: Therapeutics based on this peptide's action are now first-line for type 2 diabetes and are transforming obesity management, demonstrating unprecedented efficacy in weight reduction and cardiometabolic risk reduction.


  • 4.DELIVERY & SHIPPING

    We specialize in global logistics for various cosmetic peptides. Your order will be handled with the utmost care, ensuring safe, reliable, and intact delivery.
    Professional and Secure Packaging
    Each bottle of peptide is protected with a special packaging solution to ensure stability and integrity during transportation.
    We can also customize packaging according to customer needs.
    Shipping Methods 
    Main Method: International Air Freight

    We primarily use DHL, FedEx, UPS, and TNT because of their global reliability, speed, and advanced tracking systems. Air freight ensures the fastest transit time and minimizes the impact of environmental factors on the product.

Premium API Oxandrolone Ucinky Manufacturing
May 25, 26
Premium API Oxandrolone Ucinky Manufacturing
Premium API Oxandrolone Ucinky Manufacturing Leading global supplier of high-purity chemical raw materials for pharmaceutical grade Oxandrolone Ucinky, combining precision engineering with industrial scale. 5000 kg Annual Output 120 Countries Served 5 Days Sample Lead Time 99.7 On-Time Delivery Industrial Precision Pure Chemical Synthesis Engineering the future of pharmaceutical intermediates with unmatched stability. Our facility stands as a global leader in the oxandrolone ucinky sector, utilizing CRYOGENIC CRYSTALLIZATION and advanced chromatography to ensure an assay purity exceeding 99.8. We integrate a fully automated closed-loop system that eliminates human error and contamination.
Clinical Benefits and Applications of Oxandrolone Therapy
May 22, 26
Clinical Benefits and Applications of Oxandrolone Therapy
Oxandrolone therapy represents a sophisticated intersection of endocrine science and regenerative medicine, primarily utilized to address muscle wasting and metabolic dysfunction. In the global pharmaceutical landscape, this specific approach to androgen therapy is valued for its unique ability to promote protein synthesis while exhibiting a lower androgenic profile compared to traditional steroids, making it a critical tool for patients recovering from severe trauma or chronic illness. From a clinical perspective, understanding the nuances of oxandrolone therapy is essential for optimizing patient outcomes in weight gain and tissue repair.
Clinical Benefits and Production of Oxandrolone Steroid
May 20, 26
Clinical Benefits and Production of Oxandrolone Steroid
The global pharmaceutical landscape has seen a significant rise in the demand for highly specialized anabolic agents, among which the oxandrolone steroid stands out due to its unique chemical profile and therapeutic versatility. As a modified version of dihydrotestosterone, this compound provides a potent means of addressing muscle wasting and metabolic deficits, making it a critical asset in both clinical rehabilitation and advanced physiological research. Understanding the nuances of this synthetic compound is essential for healthcare providers and researchers alike, as it balances efficacy with a relatively lower androgenic profile compared to other steroids.

If you are interested in our products, you can choose to leave your information here, and we will be in touch with you shortly.