Glucagon-Like Peptide I (7-36), amide, human CAS NO.107444-51-9

Glucagon-Like Peptide I (7-36), amide, human CAS NO.107444-51-9

Glucagon-Like Peptide I (7-36), amide, human CAS NO.107444-51-9

Glucagon-Like Peptide I (7-36), amide, human CAS NO.107444-51-9

Glucagon-Like Peptide I (7-36), amide, human CAS NO.107444-51-9

Glucagon-Like Peptide I (7-36), amide, human (CAS 107444-51-9) is the definitive, bioactive 30-amino acid incretin hormone, representing the primary circulating form of endogenous human GLP-1. This synthetic peptide fragment (sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂) is C-terminally amidated, mirroring its natural post-translational modification, which is crucial for receptor binding and stability. As the major incretin hormone, it potently stimulates glucose-dependent insulin secretion, inhibits glucagon release, and promotes satiety. Supplied as a high-purity lyophilized powder, it serves as the indispensable reference standard for GLP-1 receptor research, metabolic studies, and drug discovery.



TECHNICAL SPECIFICATIONS


Item
Specification
Product Name
Glucagon-Like Peptide I (7-36), amide, human (GLP-1 (7-36) amide)
CAS NO.
107444-51-9
Appearance
White to off-white lyophilized powder
Molecular Formula
C149H226N40O45
Molecular Weight
3297.7g/mol 
Purity (RP-HPLC)
≥95%
Solubility

Soluble in water (≥1 mg/mL); soluble in DMSO; solubility can be enhanced by heating to 37°C and ultrasonic oscillation

Endotoxin≤1.0 EU/mg
Biological Activity
 Potent glucose-dependent insulinotropic peptide; stimulates insulin gene transcription and secretion in pancreatic β-cells
Storage Conditions
Store desiccated at ≤-20°C, avoid repeated freeze-thaw cycles.
Stock Location
Stock in USA
MOQ
1g


1.MECHANISM OF ACTION

GLP-1 (7-36) amide exerts its glucoregulatory and metabolic effects via high-affinity binding to the GLP-1 Receptor (GLP-1R), a Class B G-protein coupled receptor (GPCR). Receptor activation primarily engages the Gs-protein, stimulating adenylate cyclase and elevating intracellular cyclic AMP (cAMP) levels. This cascade activates both Protein Kinase A (PKA) and cAMP-regulated guanine nucleotide exchange factor (Epac2). 


    2.PRODUCT INDICATIONS

  • Molecular Pharmacology: Serves as the native ligand for GLP-1R binding assays (radioligand/fluorescence), receptor activation studies, and intracellular signaling analysis (cAMP, calcium).

  • In VitroBeta-Cell Physiology: Defines baseline insulinotropic activity in pancreatic beta-cell lines (e.g., INS-1, MIN6) and primary human/rodent islets to evaluate beta-cell function and survival.

  • Metabolic Disease Modeling: Establishes standard GLP-1 responses in cellular models of insulin resistance, glucotoxicity, and lipotoxicity.

  • Comparative Drug Screening: Acts as the primary reference compound for evaluating the potency and efficacy of synthetic GLP-1R agonists (e.g., liraglutide, semaglutide) and multi-agonists in development.

     

    3.CLINICAL EFFICACY OF PRODUCT

  • Pivotal Physiological Role: It is the most potent known physiological stimulator of glucose-dependent insulin secretion ("the incretin effect"), responsible for up to 70% of postprandial insulin release. Its efficacy in humans is undisputed.

  • Therapeutic Prototype with Limitation: Its clinical application as a native peptide is precluded by rapid enzymatic degradation by Dipeptidyl Peptidase-4 (DPP-IV), resulting in a half-life of<2 minutes.="">

  • Foundation for Blockbuster Therapeutics: This limitation directly fueled the development of DPP-IV-resistant GLP-1R agonists, which constitute a cornerstone of modern metabolic therapy:
    • Short-acting (exenatide, lixisenatide): Control postprandial glucose.

    • Long-acting (liraglutide, dulaglutide, semaglutide): Provide superior glycemic control, weight loss, and cardiovascular/renal benefits.

    • Oral semaglutide: A landmark achievement in peptide delivery.

  •    

    4.DELIVERY & SHIPPING

    We specialize in global logistics for various cosmetic peptides. Your order will be handled with the utmost care, ensuring safe, reliable, and intact delivery.
    Professional and Secure Packaging
    Each bottle of peptide is protected with a special packaging solution to ensure stability and integrity during transportation.
    We can also customize packaging according to customer needs.
    Shipping Methods 
    Main Method: International Air Freight

    We primarily use DHL, FedEx, UPS, and TNT because of their global reliability, speed, and advanced tracking systems. Air freight ensures the fastest transit time and minimizes the impact of environmental factors on the product.

Premium API Oxandrolone Ucinky Manufacturing
May 25, 26
Premium API Oxandrolone Ucinky Manufacturing
Premium API Oxandrolone Ucinky Manufacturing Leading global supplier of high-purity chemical raw materials for pharmaceutical grade Oxandrolone Ucinky, combining precision engineering with industrial scale. 5000 kg Annual Output 120 Countries Served 5 Days Sample Lead Time 99.7 On-Time Delivery Industrial Precision Pure Chemical Synthesis Engineering the future of pharmaceutical intermediates with unmatched stability. Our facility stands as a global leader in the oxandrolone ucinky sector, utilizing CRYOGENIC CRYSTALLIZATION and advanced chromatography to ensure an assay purity exceeding 99.8. We integrate a fully automated closed-loop system that eliminates human error and contamination.
Clinical Benefits and Applications of Oxandrolone Therapy
May 22, 26
Clinical Benefits and Applications of Oxandrolone Therapy
Oxandrolone therapy represents a sophisticated intersection of endocrine science and regenerative medicine, primarily utilized to address muscle wasting and metabolic dysfunction. In the global pharmaceutical landscape, this specific approach to androgen therapy is valued for its unique ability to promote protein synthesis while exhibiting a lower androgenic profile compared to traditional steroids, making it a critical tool for patients recovering from severe trauma or chronic illness. From a clinical perspective, understanding the nuances of oxandrolone therapy is essential for optimizing patient outcomes in weight gain and tissue repair.
Clinical Benefits and Production of Oxandrolone Steroid
May 20, 26
Clinical Benefits and Production of Oxandrolone Steroid
The global pharmaceutical landscape has seen a significant rise in the demand for highly specialized anabolic agents, among which the oxandrolone steroid stands out due to its unique chemical profile and therapeutic versatility. As a modified version of dihydrotestosterone, this compound provides a potent means of addressing muscle wasting and metabolic deficits, making it a critical asset in both clinical rehabilitation and advanced physiological research. Understanding the nuances of this synthetic compound is essential for healthcare providers and researchers alike, as it balances efficacy with a relatively lower androgenic profile compared to other steroids.

If you are interested in our products, you can choose to leave your information here, and we will be in touch with you shortly.